PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00937_0030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 767aa    MW: 82266.8 Da    PI: 8.9847
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00937_0030genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.82.5e-13189235148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g W++eEd ll+++v+q G ++Wk+ a+++  gR +kqc++rw+++l
    kfl00937_0030 189 KGQWSQEEDALLLRLVAQGGAKNWKAKAQHLT-GRVAKQCRERWHNHL 235
                      799****************************9.*************97 PP

2Myb_DNA-binding52.51.1e-16241283145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++W++eE+ +l+ a  q+G++ W+ Ia+ ++ gRt++ +k++w+
    kfl00937_0030 241 KDPWSAEEEAQLAAAYSQHGPK-WSQIAKVLP-GRTDNAIKNHWN 283
                      689*****************99.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.904184235IPR017930Myb domain
SuperFamilySSF466898.99E-28187282IPR009057Homeodomain-like
SMARTSM007176.4E-10188237IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-23190242IPR009057Homeodomain-like
PfamPF139212.1E-15192252No hitNo description
CDDcd001673.44E-11192235No hitNo description
PROSITE profilePS5129422.132236290IPR017930Myb domain
SMARTSM007173.0E-15240288IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-20243289IPR009057Homeodomain-like
CDDcd001671.28E-5258283No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 767 aa     Download sequence    Send to blast
MSRYIKDKRP GDPILTTYRR KYRYLVLPQC PPIVRAKCSC WLREPHSAKF QCGHEKDHVL  60
RECPLSPTMT PPPPPVSPLP VPPVLSPAPP CCPSSNPAAS ACTSTGAHSS LPEWPTNVPP  120
LPPLPRGWPR GPPREATSCS PESREFREGD KGPWQDLSQH AAAGPLPPWP APELGLPLWG  180
GAAYQPQVKG QWSQEEDALL LRLVAQGGAK NWKAKAQHLT GRVAKQCRER WHNHLAPDVN  240
KDPWSAEEEA QLAAAYSQHG PKWSQIAKVL PGRTDNAIKN HWNAIGKRKY TLEQRLRGGS  300
KVWKDKPDVL ERFIHSLRTA QAAPQEPSPT TSAAPSSTLT ALGRPSQSPP PMALPSPAVP  360
SPWPLAVPLP PQAAADADLL RLRQLDTWRW EEHQRIQAEH HLWLLQGAAA ARAPPARPDP  420
SAHPVASAST LVSGEAAPSS EAASRVKVDP AQTGDWEGLM QEGSGESVGE PEPADRWLLW  480
LEADGPRSAT PAPAAAASSA PGAEGKAGEG PGELAPHLQL VQRWKAMQAI DEEMERRSAT  540
QPRPLARQRS GGWGSEDEVS TRKRERGRPA GARTAATCRL LAAKQEPGSL AAPPAWSAAP  600
RQALSVQDRG TNVDARLGRS GAPPLRSLSL PSSLPSGLLG EADSLAAISQ LAFEAAHELE  660
RRQLRGSDAP EPWDRAGAPR GGAPSTHVPG VPGPVPYPYP GQQRPPPQGF TNPSDPPRVA  720
SLLAALPDDA LGLKRGVDVW EGPARGWPPS AAALLGAWAD PSNPWLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C9e-331882893104C-Myb DNA-Binding Domain
1mse_C9e-331882893104C-Myb DNA-Binding Domain
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09370.16e-36myb domain protein 3r-3